PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_C8067812A.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 293aa    MW: 32215.2 Da    PI: 5.7673
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_C8067812A.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR129.52.5e-09108183590
                   FAR1   5 eYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                            e+A++ GF +r  ks+ +  +++  +++ vC + gk+  e+++         + r++C a +++ ++kd+ w+v++ +  HnH+l+
  Traes_4BL_C8067812A.2 108 EFAEHPGFGIRYGKSRLN-VSRTKCMQDIVCGCAGKPIVENTR---------SCRCECPALIRLLRTKDNGWYVAEHRDGHNHALS 183
                            7999**********9998.445568899*******99886555.........99******************************97 PP

2FAR124.21.1e-072392804990
                   FAR1  49 ekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                            +   +++ + r++C a +++ + +d+ w++++ ++ HnH+l+
  Traes_4BL_C8067812A.2 239 KAGVENTRSCRCECPALIRLLRAEDNGWYIAEHRESHNHSLS 280
                            4567889999*****************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.7E-6108183IPR004330FAR1 DNA binding domain
PfamPF031011.1E-4239280IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MEFLLQPLNS RTFLEEVNDN NGAMEPVRFP VSAVAEVEDP APAASSADGQ ICGAEAAGAD  60
MAQCSEHSME QIDPKTPGRT QRVHVGAAAL RRPPCPDRVT ALEKTDREFA EHPGFGIRYG  120
KSRLNVSRTK CMQDIVCGCA GKPIVENTRS CRCECPALIR LLRTKDNGWY VAEHRDGHNH  180
ALSQTYGQTI HWPTAVSAEA RICVMDTAAV VNEGQLASGL GALNWKDEST CFYLELEDKA  240
GVENTRSCRC ECPALIRLLR AEDNGWYIAE HRESHNHSLS LNLDLKLHCI SGD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753620.11e-37PREDICTED: putative protein FAR1-RELATED SEQUENCE 10
TrEMBLW5E7000.0W5E700_WHEAT; Uncharacterized protein
STRINGBRADI1G32950.13e-39(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP6191991
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]